![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) ![]() |
![]() | Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
![]() | Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
![]() | Species Escherichia coli [TaxId:562] [53097] (26 PDB entries) |
![]() | Domain d2bwwa1: 2bww A:1-176 [129389] Other proteins in same PDB: d2bwwa2 automatically matched to d1a16_1 complexed with flc, mg, mn, mrd; mutant |
PDB Entry: 2bww (more details), 2.61 Å
SCOP Domain Sequences for d2bwwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwwa1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d2bwwa1: