Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein automated matches [195197] (4 species) not a true protein |
Domain d2bwua2: 2bwu A:177-440 [129386] Other proteins in same PDB: d2bwua1 automated match to d1wl9a2 complexed with flc, mg, na |
PDB Entry: 2bwu (more details), 2.2 Å
SCOPe Domain Sequences for d2bwua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwua2 d.127.1.1 (A:177-440) automated matches {Escherichia coli [TaxId: 562]} speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg engcilhytenecemrdgdlvlidagceykgyagaitrtfpvngkftqaqreiydivles letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn enltasvvkkpeeiealmvaarkq
Timeline for d2bwua2: