Lineage for d2bwua2 (2bwu A:177-440)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668263Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 1668264Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 1668265Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 1668398Protein automated matches [195197] (4 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255067] (7 PDB entries)
  8. 1668405Domain d2bwua2: 2bwu A:177-440 [129386]
    Other proteins in same PDB: d2bwua1
    automated match to d1wl9a2
    complexed with flc, mg, na

Details for d2bwua2

PDB Entry: 2bwu (more details), 2.2 Å

PDB Description: asp271ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d2bwua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwua2 d.127.1.1 (A:177-440) automated matches {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagaitrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOPe Domain Coordinates for d2bwua2:

Click to download the PDB-style file with coordinates for d2bwua2.
(The format of our PDB-style files is described here.)

Timeline for d2bwua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwua1