Lineage for d2bwua2 (2bwu A:177-440)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins) 
Protein Aminopeptidase P, C-terminal domain [55928] (2 species) Species Escherichia coli [TaxId:562] [55929] (23 PDB entries) 
Domain d2bwua2: 2bwu A:177-440 [129386]
Other proteins in same PDB: d2bwua1
automatically matched to d1a16_2
complexed with flc, mg, na; mutant
Details for d2bwua2
PDB Entry: 2bwu (more details), 2.2 Å
PDB Description: asp271ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase pSCOP Domain Sequences for d2bwua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwua2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagaitrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq
SCOP Domain Coordinates for d2bwua2:
Click to download the PDB-style file with coordinates for d2bwua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bwua2:
- d2bwua2 is new in SCOP 1.73
- d2bwua2 appears in SCOP 1.75
- d2bwua2 appears in the current release, SCOPe 2.08
View in 3D
