Lineage for d2bwua2 (2bwu A:177-440)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
duplication: composed of two very similar alpha+beta foldsSuperfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) 
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) 
Protein automated matches [195197] (6 species)
not a true protein
Species Escherichia coli [TaxId:562] [255067] (7 PDB entries) 
Domain d2bwua2: 2bwu A:177-440 [129386]
Other proteins in same PDB: d2bwua1
automated match to d1wl9a2
complexed with flc, mg, na
Details for d2bwua2
PDB Entry: 2bwu (more details), 2.2 Å
PDB Description: asp271ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase pSCOPe Domain Sequences for d2bwua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwua2 d.127.1.1 (A:177-440) automated matches {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagaitrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq
SCOPe Domain Coordinates for d2bwua2:
Click to download the PDB-style file with coordinates for d2bwua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bwua2:
- d2bwua2 first appeared in SCOP 1.73
- d2bwua2 appears in SCOPe 2.07
View in 3D
