![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) ![]() |
![]() | Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) |
![]() | Domain d2bwta1: 2bwt A:1-176 [129383] Other proteins in same PDB: d2bwta2 automated match to d2v3za1 complexed with flc, mg, mn, mpd |
PDB Entry: 2bwt (more details), 2.9 Å
SCOPe Domain Sequences for d2bwta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwta1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d2bwta1: