Lineage for d2bwqa1 (2bwq A:729-853)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 661406Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 661407Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 661469Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 661489Protein Regulating synaptic membrane exocytosis protein, rim2 [101564] (1 species)
  7. 661490Species Human (Homo sapiens) [TaxId:9606] [101565] (2 PDB entries)
  8. 661491Domain d2bwqa1: 2bwq A:729-853 [129380]
    automatically matched to d1v27a_
    complexed with so4

Details for d2bwqa1

PDB Entry: 2bwq (more details), 1.41 Å

PDB Description: crystal structure of the rim2 c2a-domain at 1.4 angstrom resolution
PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 2

SCOP Domain Sequences for d2bwqa1:

Sequence, based on SEQRES records: (download)

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}
gqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtktvkk
tlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieletallddeph
wyklq

Sequence, based on observed residues (ATOM records): (download)

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}
gqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtktvkk
tlepkwnqtfiyspvhrrefrermleitlwdqseflgeilieletallddephwyklq

SCOP Domain Coordinates for d2bwqa1:

Click to download the PDB-style file with coordinates for d2bwqa1.
(The format of our PDB-style files is described here.)

Timeline for d2bwqa1: