Lineage for d2bwqa_ (2bwq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2773040Protein automated matches [190234] (2 species)
    not a true protein
  7. 2773047Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)
  8. 2773049Domain d2bwqa_: 2bwq A: [129380]
    automated match to d1v27a_
    complexed with so4

Details for d2bwqa_

PDB Entry: 2bwq (more details), 1.41 Å

PDB Description: crystal structure of the rim2 c2a-domain at 1.4 angstrom resolution
PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 2

SCOPe Domain Sequences for d2bwqa_:

Sequence, based on SEQRES records: (download)

>d2bwqa_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qflsgqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtk
tvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieletalld
dephwyklq

Sequence, based on observed residues (ATOM records): (download)

>d2bwqa_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qflsgqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtk
tvkktlepkwnqtfiyspvhrrefrermleitlwdqseflgeilieletallddephwyk
lq

SCOPe Domain Coordinates for d2bwqa_:

Click to download the PDB-style file with coordinates for d2bwqa_.
(The format of our PDB-style files is described here.)

Timeline for d2bwqa_: