Lineage for d2bwpe1 (2bwp E:2-397)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840994Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 841049Protein 5-aminolevulinate synthase [142676] (1 species)
  7. 841050Species Rhodobacter capsulatus [TaxId:1061] [142677] (3 PDB entries)
    Uniprot P18079 2-397
  8. 841058Domain d2bwpe1: 2bwp E:2-397 [129379]
    automatically matched to 2BWN A:2-397
    complexed with acy, plg

Details for d2bwpe1

PDB Entry: 2bwp (more details), 2.7 Å

PDB Description: 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine
PDB Compounds: (E:) 5-aminolevulinate synthase

SCOP Domain Sequences for d2bwpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwpe1 c.67.1.4 (E:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]}
dynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmgq
hpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynanda
tlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapkl
iafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhridi
fngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaegq
klrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqpi
nfptvprgterlrftpspvhdlkqidglvhamdllw

SCOP Domain Coordinates for d2bwpe1:

Click to download the PDB-style file with coordinates for d2bwpe1.
(The format of our PDB-style files is described here.)

Timeline for d2bwpe1: