Lineage for d2bwpe_ (2bwp E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896442Species Rhodobacter capsulatus [TaxId:1061] [187497] (3 PDB entries)
  8. 2896446Domain d2bwpe_: 2bwp E: [129379]
    automated match to d2bwna1
    complexed with acy, plg

Details for d2bwpe_

PDB Entry: 2bwp (more details), 2.7 Å

PDB Description: 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine
PDB Compounds: (E:) 5-aminolevulinate synthase

SCOPe Domain Sequences for d2bwpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwpe_ c.67.1.4 (E:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
infptvprgterlrftpspvhdlkqidglvhamdllwa

SCOPe Domain Coordinates for d2bwpe_:

Click to download the PDB-style file with coordinates for d2bwpe_.
(The format of our PDB-style files is described here.)

Timeline for d2bwpe_: