Lineage for d2bwoe_ (2bwo E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147847Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2148164Protein automated matches [190152] (22 species)
    not a true protein
  7. 2148213Species Rhodobacter capsulatus [TaxId:1061] [187497] (3 PDB entries)
  8. 2148224Domain d2bwoe_: 2bwo E: [129375]
    automated match to d2bwna1
    complexed with plp, sca

Details for d2bwoe_

PDB Entry: 2bwo (more details), 2.8 Å

PDB Description: 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa
PDB Compounds: (E:) 5-aminolevulinate synthase

SCOPe Domain Sequences for d2bwoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwoe_ c.67.1.4 (E:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
infptvprgterlrftpspvhdlkqidglvhamdllwar

SCOPe Domain Coordinates for d2bwoe_:

Click to download the PDB-style file with coordinates for d2bwoe_.
(The format of our PDB-style files is described here.)

Timeline for d2bwoe_: