Lineage for d2bwnd1 (2bwn D:2-397)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705854Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 705909Protein 5-aminolevulinate synthase [142676] (1 species)
  7. 705910Species Rhodobacter capsulatus [TaxId:1061] [142677] (3 PDB entries)
  8. 705913Domain d2bwnd1: 2bwn D:2-397 [129370]
    automatically matched to 2BWN A:2-397
    complexed with acy, cl, fmt, sin, so4

Details for d2bwnd1

PDB Entry: 2bwn (more details), 2.1 Å

PDB Description: 5-aminolevulinate synthase from rhodobacter capsulatus
PDB Compounds: (D:) 5-aminolevulinate synthase

SCOP Domain Sequences for d2bwnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwnd1 c.67.1.4 (D:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]}
dynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmgq
hpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynanda
tlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapkl
iafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhridi
fngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaegq
klrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqpi
nfptvprgterlrftpspvhdlkqidglvhamdllw

SCOP Domain Coordinates for d2bwnd1:

Click to download the PDB-style file with coordinates for d2bwnd1.
(The format of our PDB-style files is described here.)

Timeline for d2bwnd1: