Lineage for d2bwna1 (2bwn A:2-397)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131762Protein 5-aminolevulinate synthase [142676] (1 species)
  7. 2131763Species Rhodobacter capsulatus [TaxId:1061] [142677] (1 PDB entry)
    Uniprot P18079 2-397
  8. 2131764Domain d2bwna1: 2bwn A:2-397 [129368]
    Other proteins in same PDB: d2bwnb_, d2bwnd_, d2bwne_
    complexed with acy, cl, fmt, plp, sin, so4

Details for d2bwna1

PDB Entry: 2bwn (more details), 2.1 Å

PDB Description: 5-aminolevulinate synthase from rhodobacter capsulatus
PDB Compounds: (A:) 5-aminolevulinate synthase

SCOPe Domain Sequences for d2bwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]}
dynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmgq
hpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynanda
tlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapkl
iafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhridi
fngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaegq
klrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqpi
nfptvprgterlrftpspvhdlkqidglvhamdllw

SCOPe Domain Coordinates for d2bwna1:

Click to download the PDB-style file with coordinates for d2bwna1.
(The format of our PDB-style files is described here.)

Timeline for d2bwna1: