SCOPe 2.04: Domain d2bwia1: 2bwi A:7-166

Lineage for d2bwia1 (2bwi A:7-166)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries)

8. Domain d2bwia1: 2bwi A:7-166 [129366]
   automated match to d1nifa1
   complexed with act, cu, mli, no2

Details for d2bwia1

PDB Entry: 2bwi, 1.1 Å

PDB Description: atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2bwia1:

Sequence; same for both SEQRES and ATOM records:

>d2bwia1 b.6.1.3 (A:7-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

Timeline for d2bwia1:

• d2bwia1 first appeared in SCOP 1.73
  
• d2bwia1 appears in SCOPe 2.03
  
• d2bwia1 appears in SCOPe 2.05
  
• d2bwia1 appears in the current release, SCOPe 2.08