Lineage for d2bwia1 (2bwi A:8-164)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940701Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 940824Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 941045Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 941050Domain d2bwia1: 2bwi A:8-164 [129366]
    automatically matched to d1gs6x1
    complexed with act, cu, mli, no2

Details for d2bwia1

PDB Entry: 2bwi (more details), 1.1 Å

PDB Description: atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2bwia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwia1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkd

SCOPe Domain Coordinates for d2bwia1:

Click to download the PDB-style file with coordinates for d2bwia1.
(The format of our PDB-style files is described here.)

Timeline for d2bwia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwia2