SCOP 1.73: Domain d2bwha1: 2bwh A:1-153

Lineage for d2bwha1 (2bwh A:1-153)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d2bwha1: 2bwh A:1-153 [129365]
   automatically matched to d1ltw__
   complexed with cmo, hem; mutant

Details for d2bwha1

PDB Entry: 2bwh, 1.9 Å

PDB Description: laue structure of a short lived state of l29w myoglobin

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2bwha1:

Sequence; same for both SEQRES and ATOM records:

>d2bwha1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2bwha1:

• d2bwha1 is new in SCOP 1.73
  
• d2bwha1 appears in SCOP 1.75
  
• d2bwha1 appears in the current release, SCOPe 2.08