Lineage for d2bwha1 (2bwh A:1-153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688303Domain d2bwha1: 2bwh A:1-153 [129365]
    automatically matched to d1ltw__
    complexed with cmo, hem

Details for d2bwha1

PDB Entry: 2bwh (more details), 1.9 Å

PDB Description: laue structure of a short lived state of l29w myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2bwha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwha1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d2bwha1:

Click to download the PDB-style file with coordinates for d2bwha1.
(The format of our PDB-style files is described here.)

Timeline for d2bwha1: