SCOP 1.75: Domain d2bwfb1: 2bwf B:2-74

Lineage for d2bwfb1 (2bwf B:2-74)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein DSK2 [142940] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (2 PDB entries)
   Uniprot P48510 2-74

8. Domain d2bwfb1: 2bwf B:2-74 [129364]
   automatically matched to 2BWE S:2-74
   complexed with fmt

Details for d2bwfb1

PDB Entry: 2bwf, 1.15 Å

PDB Description: crystal structure of the ubl domain of dsk2 from s. cerevisiae

PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOP Domain Sequences for d2bwfb1:

Sequence; same for both SEQRES and ATOM records:

>d2bwfb1 d.15.1.1 (B:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
iqdghsvhlvksq

Timeline for d2bwfb1:

• d2bwfb1 first appeared in SCOP 1.73
  
• d2bwfb1 is called d2bwfb_ in SCOPe 2.01
  
• d2bwfb1 appears in the current release, SCOPe 2.08, called d2bwfb_