Lineage for d2bwfb1 (2bwf B:2-74)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717101Protein DSK2 [142940] (1 species)
  7. 717102Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (2 PDB entries)
  8. 717104Domain d2bwfb1: 2bwf B:2-74 [129364]
    automatically matched to 2BWE S:2-74
    complexed with fmt

Details for d2bwfb1

PDB Entry: 2bwf (more details), 1.15 Å

PDB Description: crystal structure of the ubl domain of dsk2 from s. cerevisiae
PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOP Domain Sequences for d2bwfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwfb1 d.15.1.1 (B:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
iqdghsvhlvksq

SCOP Domain Coordinates for d2bwfb1:

Click to download the PDB-style file with coordinates for d2bwfb1.
(The format of our PDB-style files is described here.)

Timeline for d2bwfb1: