SCOPe 2.08: Domain d2bwfb_: 2bwf B:

Lineage for d2bwfb_ (2bwf B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries)

8. Domain d2bwfb_: 2bwf B: [129364]
   automated match to d1bt0a_
   complexed with fmt

Details for d2bwfb_

PDB Entry: 2bwf, 1.15 Å

PDB Description: crystal structure of the ubl domain of dsk2 from s. cerevisiae

PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwfb_:

Sequence; same for both SEQRES and ATOM records:

>d2bwfb_ d.15.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
syhiqdghsvhlvksqp

Timeline for d2bwfb_:

• d2bwfb_ first appeared in SCOP 1.73, called d2bwfb1
  
• d2bwfb_ appears in SCOPe 2.07