SCOP 1.73: Domain d2bwfa1: 2bwf A:2-74

Lineage for d2bwfa1 (2bwf A:2-74)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein DSK2 [142940] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (2 PDB entries)

8. Domain d2bwfa1: 2bwf A:2-74 [129363]
   automatically matched to 2BWE S:2-74
   complexed with fmt

Details for d2bwfa1

PDB Entry: 2bwf, 1.15 Å

PDB Description: crystal structure of the ubl domain of dsk2 from s. cerevisiae

PDB Compounds: (A:) ubiquitin-like protein dsk2

SCOP Domain Sequences for d2bwfa1:

Sequence; same for both SEQRES and ATOM records:

>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
iqdghsvhlvksq

Timeline for d2bwfa1:

• d2bwfa1 is new in SCOP 1.73
  
• d2bwfa1 appears in SCOP 1.75
  
• d2bwfa1 appears in the current release, SCOPe 2.08, called d2bwfa_