SCOP 1.75: Domain d2bweu1: 2bwe U:3-74

Lineage for d2bweu1 (2bwe U:3-74)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein DSK2 [142940] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (2 PDB entries)
   Uniprot P48510 2-74

8. Domain d2bweu1: 2bwe U:3-74 [129362]
   Other proteins in same PDB: d2bwea1, d2bweb1, d2bwec1, d2bwed1, d2bwee1, d2bwef1, d2bweg1, d2bweh1, d2bwei1, d2bwej1, d2bwek1, d2bwel1, d2bwem1, d2bwen1, d2bweo1, d2bwep1, d2bweq1, d2bwer1
   automatically matched to 2BWE S:2-74

Details for d2bweu1

PDB Entry: 2bwe, 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2

PDB Compounds: (U:) dsk2

SCOP Domain Sequences for d2bweu1:

Sequence; same for both SEQRES and ATOM records:

>d2bweu1 d.15.1.1 (U:3-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
qdghsvhlvksq

Timeline for d2bweu1:

• d2bweu1 first appeared in SCOP 1.73
  
• d2bweu1 appears in SCOPe 2.01
  
• d2bweu1 appears in the current release, SCOPe 2.08, called d2bweu_