SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bweu_ (2bwe U:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (19 species)
    not a true protein
  7. 2159470Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (7 PDB entries)
  8. 2159481Domain d2bweu_: 2bwe U: [129362]
    Other proteins in same PDB: d2bwea1, d2bweb_, d2bwec_, d2bwed_, d2bwee_, d2bwef_, d2bweg_, d2bweh_, d2bwei_, d2bwej_, d2bwek_, d2bwel_, d2bwem_, d2bwen_, d2bweo_, d2bwep_, d2bweq_, d2bwer_, d2bwes1
    automated match to d2bwfa_

Details for d2bweu_

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (U:) dsk2

SCOPe Domain Sequences for d2bweu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bweu_ d.15.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
qdghsvhlvksq

SCOPe Domain Coordinates for d2bweu_:

Click to download the PDB-style file with coordinates for d2bweu_.
(The format of our PDB-style files is described here.)

Timeline for d2bweu_: