SCOPe 2.08: Domain d2bweu_: 2bwe U:

Lineage for d2bweu_ (2bwe U:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries)

8. Domain d2bweu_: 2bwe U: [129362]
   Other proteins in same PDB: d2bwea1, d2bweb_, d2bwec_, d2bwed_, d2bwee_, d2bwef_, d2bweg_, d2bweh_, d2bwei_, d2bwej_, d2bwek_, d2bwel_, d2bwem_, d2bwen_, d2bweo_, d2bwep_, d2bweq_, d2bwer_, d2bwes1
   automated match to d2bwfa_

Details for d2bweu_

PDB Entry: 2bwe, 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2

PDB Compounds: (U:) dsk2

SCOPe Domain Sequences for d2bweu_:

Sequence; same for both SEQRES and ATOM records:

>d2bweu_ d.15.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
qdghsvhlvksq

Timeline for d2bweu_:

• d2bweu_ first appeared in SCOP 1.73, called d2bweu1
  
• d2bweu_ appears in SCOPe 2.07