SCOP 1.73: Domain d2bwet1: 2bwe T:2-74

Lineage for d2bwet1 (2bwe T:2-74)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein DSK2 [142940] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (2 PDB entries)

8. Domain d2bwet1: 2bwe T:2-74 [129361]
   Other proteins in same PDB: d2bwea1, d2bweb1, d2bwec1, d2bwed1, d2bwee1, d2bwef1, d2bweg1, d2bweh1, d2bwei1, d2bwej1, d2bwek1, d2bwel1, d2bwem1, d2bwen1, d2bweo1, d2bwep1, d2bweq1, d2bwer1
   automatically matched to 2BWE S:2-74

Details for d2bwet1

PDB Entry: 2bwe, 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2

PDB Compounds: (T:) dsk2

SCOP Domain Sequences for d2bwet1:

Sequence; same for both SEQRES and ATOM records:

>d2bwet1 d.15.1.1 (T:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
iqdghsvhlvksq

Timeline for d2bwet1:

• d2bwet1 is new in SCOP 1.73
  
• d2bwet1 appears in SCOP 1.75
  
• d2bwet1 appears in the current release, SCOPe 2.08, called d2bwet_