Lineage for d2bwes1 (2bwe S:2-74)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402165Protein DSK2 [142940] (1 species)
  7. 1402166Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142941] (1 PDB entry)
    Uniprot P48510 2-74
  8. 1402167Domain d2bwes1: 2bwe S:2-74 [129360]
    Other proteins in same PDB: d2bwea1, d2bweb1, d2bwec1, d2bwed1, d2bwee1, d2bwef1, d2bweg1, d2bweh1, d2bwei1, d2bwej1, d2bwek1, d2bwel1, d2bwem1, d2bwen1, d2bweo1, d2bwep1, d2bweq1, d2bwer1

Details for d2bwes1

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (S:) dsk2

SCOPe Domain Sequences for d2bwes1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwes1 d.15.1.1 (S:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
iqdghsvhlvksq

SCOPe Domain Coordinates for d2bwes1:

Click to download the PDB-style file with coordinates for d2bwes1.
(The format of our PDB-style files is described here.)

Timeline for d2bwes1: