![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein automated matches [190533] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries) |
![]() | Domain d2bwer_: 2bwe R: [129359] Other proteins in same PDB: d2bwea1, d2bwes1, d2bwet_, d2bweu_ automated match to d1wr1b1 |
PDB Entry: 2bwe (more details), 3.1 Å
SCOPe Domain Sequences for d2bwer_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwer_ a.5.2.1 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
Timeline for d2bwer_: