![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (4 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein DSK2 [140323] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (2 PDB entries) Uniprot P48510 328-371! Uniprot P48510 328-373 |
![]() | Domain d2bweq1: 2bwe Q:328-371 [129358] Other proteins in same PDB: d2bwes1, d2bwet1, d2bweu1 automatically matched to 2BWE A:328-371 |
PDB Entry: 2bwe (more details), 3.1 Å
SCOPe Domain Sequences for d2bweq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bweq1 a.5.2.1 (Q:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
Timeline for d2bweq1: