Lineage for d2bwed1 (2bwe D:328-371)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636379Protein DSK2 [140323] (1 species)
  7. 636380Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (3 PDB entries)
  8. 636393Domain d2bwed1: 2bwe D:328-371 [129345]
    Other proteins in same PDB: d2bwes1, d2bwet1, d2bweu1
    automatically matched to 2BWE A:328-371

Details for d2bwed1

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (D:) dsk2

SCOP Domain Sequences for d2bwed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwed1 a.5.2.1 (D:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

SCOP Domain Coordinates for d2bwed1:

Click to download the PDB-style file with coordinates for d2bwed1.
(The format of our PDB-style files is described here.)

Timeline for d2bwed1: