Lineage for d2bwed_ (2bwe D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696138Protein automated matches [190533] (3 species)
    not a true protein
  7. 2696139Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)
  8. 2696152Domain d2bwed_: 2bwe D: [129345]
    Other proteins in same PDB: d2bwea1, d2bwes1, d2bwet_, d2bweu_
    automated match to d1wr1b1

Details for d2bwed_

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (D:) dsk2

SCOPe Domain Sequences for d2bwed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwed_ a.5.2.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

SCOPe Domain Coordinates for d2bwed_:

Click to download the PDB-style file with coordinates for d2bwed_.
(The format of our PDB-style files is described here.)

Timeline for d2bwed_: