Lineage for d2bwea1 (2bwe A:328-371)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696058Protein DSK2 [140323] (1 species)
  7. 2696059Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (2 PDB entries)
    Uniprot P48510 328-371! Uniprot P48510 328-373
  8. 2696060Domain d2bwea1: 2bwe A:328-371 [129342]
    Other proteins in same PDB: d2bweb_, d2bwec_, d2bwed_, d2bwee_, d2bwef_, d2bweg_, d2bweh_, d2bwei_, d2bwej_, d2bwek_, d2bwel_, d2bwem_, d2bwen_, d2bweo_, d2bwep_, d2bweq_, d2bwer_, d2bwes1, d2bwet_, d2bweu_

Details for d2bwea1

PDB Entry: 2bwe (more details), 3.1 Å

PDB Description: the crystal structure of the complex between the uba and ubl domains of dsk2
PDB Compounds: (A:) dsk2

SCOPe Domain Sequences for d2bwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwea1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

SCOPe Domain Coordinates for d2bwea1:

Click to download the PDB-style file with coordinates for d2bwea1.
(The format of our PDB-style files is described here.)

Timeline for d2bwea1: