SCOPe 2.07: Domain d2bwca_: 2bwc A:

Lineage for d2bwca_ (2bwc A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)

7. Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)

8. Domain d2bwca_: 2bwc A: [129338]
   automated match to d1h0ba_
   complexed with glc, gol, so4

Details for d2bwca_

PDB Entry: 2bwc, 2.15 Å

PDB Description: structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose (5 minute soak)

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2bwca_:

Sequence; same for both SEQRES and ATOM records:

>d2bwca_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl

Timeline for d2bwca_:

• d2bwca_ first appeared in SCOP 1.73, called d2bwca1
  
• d2bwca_ appears in SCOPe 2.06
  
• d2bwca_ appears in the current release, SCOPe 2.08