Lineage for d2bwbi_ (2bwb I:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309397Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2309501Protein automated matches [190533] (3 species)
    not a true protein
  7. 2309502Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)
  8. 2309512Domain d2bwbi_: 2bwb I: [129337]
    automated match to d1wr1b1

Details for d2bwbi_

PDB Entry: 2bwb (more details), 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
PDB Compounds: (I:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwbi_:

Sequence, based on SEQRES records: (download)

>d2bwbi_ a.5.2.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln

Sequence, based on observed residues (ATOM records): (download)

>d2bwbi_ a.5.2.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpeeryehqlrqlnfdfdrnvaalrrsggsvqgaldslln

SCOPe Domain Coordinates for d2bwbi_:

Click to download the PDB-style file with coordinates for d2bwbi_.
(The format of our PDB-style files is described here.)

Timeline for d2bwbi_: