Lineage for d2bwbf1 (2bwb F:328-370)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636379Protein DSK2 [140323] (1 species)
  7. 636380Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140324] (3 PDB entries)
  8. 636386Domain d2bwbf1: 2bwb F:328-370 [129334]
    automatically matched to 2BWE A:328-371

Details for d2bwbf1

PDB Entry: 2bwb (more details), 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
PDB Compounds: (F:) ubiquitin-like protein dsk2

SCOP Domain Sequences for d2bwbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwbf1 a.5.2.1 (F:328-370) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
peeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln

SCOP Domain Coordinates for d2bwbf1:

Click to download the PDB-style file with coordinates for d2bwbf1.
(The format of our PDB-style files is described here.)

Timeline for d2bwbf1: