Lineage for d2bwbe_ (2bwb E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985465Protein automated matches [190533] (3 species)
    not a true protein
  7. 1985466Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)
  8. 1985472Domain d2bwbe_: 2bwb E: [129333]
    automated match to d1wr1b1

Details for d2bwbe_

PDB Entry: 2bwb (more details), 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
PDB Compounds: (E:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwbe_ a.5.2.1 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln

SCOPe Domain Coordinates for d2bwbe_:

Click to download the PDB-style file with coordinates for d2bwbe_.
(The format of our PDB-style files is described here.)

Timeline for d2bwbe_: