SCOP 1.73: Domain d2bwab1: 2bwa B:2-227

Lineage for d2bwab1 (2bwa B:2-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)

7. Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)

8. Domain d2bwab1: 2bwa B:2-227 [129328]
   automatically matched to d1h0ba_
   complexed with bgc, glc, gol, so4

Details for d2bwab1

PDB Entry: 2bwa, 1.68 Å

PDB Description: structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.

PDB Compounds: (B:) endoglucanase

SCOP Domain Sequences for d2bwab1:

Sequence; same for both SEQRES and ATOM records:

>d2bwab1 b.29.1.11 (B:2-227) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl

Timeline for d2bwab1:

• d2bwab1 is new in SCOP 1.73
  
• d2bwab1 appears in SCOP 1.75
  
• d2bwab1 appears in the current release, SCOPe 2.08, called d2bwab_