Lineage for d2bwaa1 (2bwa A:2-227)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795037Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 795038Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 795053Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)
  8. 795056Domain d2bwaa1: 2bwa A:2-227 [129327]
    automatically matched to d1h0ba_
    complexed with bgc, glc, gol, so4

Details for d2bwaa1

PDB Entry: 2bwa (more details), 1.68 Å

PDB Description: structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.
PDB Compounds: (A:) endoglucanase

SCOP Domain Sequences for d2bwaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwaa1 b.29.1.11 (A:2-227) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl

SCOP Domain Coordinates for d2bwaa1:

Click to download the PDB-style file with coordinates for d2bwaa1.
(The format of our PDB-style files is described here.)

Timeline for d2bwaa1: