Lineage for d2bwaa_ (2bwa A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780056Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2780071Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)
  8. 2780074Domain d2bwaa_: 2bwa A: [129327]
    automated match to d1h0ba_
    complexed with gol, so4

Details for d2bwaa_

PDB Entry: 2bwa (more details), 1.68 Å

PDB Description: structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose, 20 minute soak.
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2bwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwaa_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl

SCOPe Domain Coordinates for d2bwaa_:

Click to download the PDB-style file with coordinates for d2bwaa_.
(The format of our PDB-style files is described here.)

Timeline for d2bwaa_: