Lineage for d2bw8b1 (2bw8 B:2-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664070Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 664085Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)
  8. 664087Domain d2bw8b1: 2bw8 B:2-227 [129325]
    automatically matched to d1h0ba_
    complexed with so4

Details for d2bw8b1

PDB Entry: 2bw8 (more details), 1.54 Å

PDB Description: native structure of endoglucanase 12a (cel12a) from rhodothermus marinus
PDB Compounds: (B:) endoglucanase

SCOP Domain Sequences for d2bw8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw8b1 b.29.1.11 (B:2-227) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl

SCOP Domain Coordinates for d2bw8b1:

Click to download the PDB-style file with coordinates for d2bw8b1.
(The format of our PDB-style files is described here.)

Timeline for d2bw8b1: