![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Achromobacter cycloclastes [TaxId:223] [49552] (15 PDB entries) |
![]() | Domain d2bw5a1: 2bw5 A:7-166 [129322] automated match to d1nifa1 complexed with act, cu, hoa, mli, po4 |
PDB Entry: 2bw5 (more details), 1.12 Å
SCOPe Domain Sequences for d2bw5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bw5a1 b.6.1.3 (A:7-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]} vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d2bw5a1: