SCOPe 2.02: Domain d2bw5a1: 2bw5 A:8-164

Lineage for d2bw5a1 (2bw5 A:8-164)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Achromobacter cycloclastes [TaxId:223] [49552] (14 PDB entries)

8. Domain d2bw5a1: 2bw5 A:8-164 [129322]
   automatically matched to d1gs6x1
   complexed with act, cu, hoa, mli, po4

Details for d2bw5a1

PDB Entry: 2bw5, 1.12 Å

PDB Description: atomic resolution structure of no-bound achromobacter cycloclastes cu nitrite reductase

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2bw5a1:

Sequence; same for both SEQRES and ATOM records:

>d2bw5a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkd

Timeline for d2bw5a1:

• d2bw5a1 first appeared in SCOP 1.73
  
• d2bw5a1 appears in SCOPe 2.01
  
• d2bw5a1 appears in SCOPe 2.03
  
• d2bw5a1 appears in the current release, SCOPe 2.08