SCOPe 2.08: Domain d2bw4a2: 2bw4 A:167-340

Lineage for d2bw4a2 (2bw4 A:167-340)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)

8. Domain d2bw4a2: 2bw4 A:167-340 [129321]
   Other proteins in same PDB: d2bw4a1
   automated match to d1nifa2
   complexed with act, cu, mli, so4
   has additional insertions and/or extensions that are not grouped together

Details for d2bw4a2

PDB Entry: 2bw4, 0.9 Å

PDB Description: atomic resolution structure of resting state of the achromobacter cycloclastes cu nitrite reductase

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2bw4a2:

Sequence; same for both SEQRES and ATOM records:

>d2bw4a2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

Timeline for d2bw4a2:

• d2bw4a2 first appeared in SCOP 1.73
  
• d2bw4a2 appears in SCOPe 2.07