![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
![]() | Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries) |
![]() | Domain d2bw4a2: 2bw4 A:167-340 [129321] Other proteins in same PDB: d2bw4a1 automated match to d1nifa2 complexed with act, cu, mli, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2bw4 (more details), 0.9 Å
SCOPe Domain Sequences for d2bw4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bw4a2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]} gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
Timeline for d2bw4a2: