![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.270: Hermes dimerisation domain [140995] (1 superfamily) multihelical, intertwinned dimer of two 4-helical strings |
![]() | Superfamily a.270.1: Hermes dimerisation domain [140996] (1 family) ![]() |
![]() | Family a.270.1.1: Hermes dimerisation domain [140997] (1 protein) |
![]() | Protein Transposase Hermes, dimerisation domain [140998] (1 species) |
![]() | Species House fly (Musca domestica) [TaxId:7370] [140999] (1 PDB entry) |
![]() | Domain d2bw3b1: 2bw3 B:79-158 [129319] Other proteins in same PDB: d2bw3a2 mutant |
PDB Entry: 2bw3 (more details), 2 Å
SCOP Domain Sequences for d2bw3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bw3b1 a.270.1.1 (B:79-158) Transposase Hermes, dimerisation domain {House fly (Musca domestica) [TaxId: 7370]} qsrelktvsadckkeaiekcaqwvvrdcrpfsavsgsgfidmikffikvgaeygdhvnve ellpspitlsrkvtsdakek
Timeline for d2bw3b1: