Lineage for d2bw3a2 (2bw3 A:163-609)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124802Family c.55.3.12: Hermes transposase-like [142508] (1 protein)
  6. 2124803Protein Transposase Hermes, catalytic domain [142509] (1 species)
  7. 2124804Species House fly (Musca domestica) [TaxId:7370] [142510] (1 PDB entry)
    Uniprot Q25442 163-609
  8. 2124805Domain d2bw3a2: 2bw3 A:163-609 [129318]
    Other proteins in same PDB: d2bw3a1, d2bw3b1

Details for d2bw3a2

PDB Entry: 2bw3 (more details), 2 Å

PDB Description: three-dimensional structure of the hermes dna transposase
PDB Compounds: (A:) transposase

SCOPe Domain Sequences for d2bw3a2:

Sequence, based on SEQRES records: (download)

>d2bw3a2 c.55.3.12 (A:163-609) Transposase Hermes, catalytic domain {House fly (Musca domestica) [TaxId: 7370]}
greiksavekdgasatidlwtdnyikrnflgvtlhyhennelrdlilglksldferstae
niykklkaifsqfnvedlssikfvtdrganvvkslannirincsshllsnvlensfeetp
elnmpilacknivkyfkkanlqhrlrsslksecptrwnstytmlrsildnwesviqilse
agetqrivhinksiiqtmvnildgferifkelqtcsspslcfvvpsilkvkeicspdvgd
vadiaklkvniiknvriiweenlsiwhytafffyppalhmqqekvaqikefclskmedle
linrmssfnelsatqlnqsdsnshnsidltshskdisttsfffpqltqnnsreppvcpsd
efefyrkeivilsedfkvmewwnlnskkypklsklalsllsipassaasertfslagnii
tekrnrigqqtvdsllflnsfyknfck

Sequence, based on observed residues (ATOM records): (download)

>d2bw3a2 c.55.3.12 (A:163-609) Transposase Hermes, catalytic domain {House fly (Musca domestica) [TaxId: 7370]}
greiksavekdgasatidlwtdnyikrnflgvtlhyhennelrdlilglksldferstae
niykklkaifsqfnvedlssikfvtdrganvvkslannirincsshllsnvlensfeetp
elnmpilacknivkyfkkanlqhrlrsslksecptrwnstytmlrsildnwesviqilse
agetqrivhinksiiqtmvnildgferifkelqtcsspslcfvvpsilkvkeicspdvgd
vadiaklkvniiknvriiweenlsiwhytafffyppalhmqqekvaqikefclskmedle
linrmssfnelsatqlnqdisttsfffpqltqnnsreppvcpsdefefyrkeivilsedf
kvmewwnlnskkypklsklalsllsipassaasertfslagniitekrnrigqqtvdsll
flnsfyknfck

SCOPe Domain Coordinates for d2bw3a2:

Click to download the PDB-style file with coordinates for d2bw3a2.
(The format of our PDB-style files is described here.)

Timeline for d2bw3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bw3a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bw3b1