Lineage for d2bw3a1 (2bw3 A:79-162)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651979Fold a.270: Hermes dimerisation domain [140995] (1 superfamily)
    multihelical, intertwinned dimer of two 4-helical strings
  4. 651980Superfamily a.270.1: Hermes dimerisation domain [140996] (1 family) (S)
  5. 651981Family a.270.1.1: Hermes dimerisation domain [140997] (1 protein)
  6. 651982Protein Transposase Hermes, dimerisation domain [140998] (1 species)
  7. 651983Species House fly (Musca domestica) [TaxId:7370] [140999] (1 PDB entry)
  8. 651984Domain d2bw3a1: 2bw3 A:79-162 [129317]
    Other proteins in same PDB: d2bw3a2
    mutant

Details for d2bw3a1

PDB Entry: 2bw3 (more details), 2 Å

PDB Description: three-dimensional structure of the hermes dna transposase
PDB Compounds: (A:) transposase

SCOP Domain Sequences for d2bw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw3a1 a.270.1.1 (A:79-162) Transposase Hermes, dimerisation domain {House fly (Musca domestica) [TaxId: 7370]}
qsrelktvsadckkeaiekcaqwvvrdcrpfsavsgsgfidmikffikvkaeygehvnve
ellpspitlsrkvtsdakekkali

SCOP Domain Coordinates for d2bw3a1:

Click to download the PDB-style file with coordinates for d2bw3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bw3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bw3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bw3b1