| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.270: Hermes dimerisation domain [140995] (1 superfamily) multihelical, intertwinned dimer of two 4-helical strings |
Superfamily a.270.1: Hermes dimerisation domain [140996] (1 family) ![]() automatically mapped to Pfam PF10683 |
| Family a.270.1.1: Hermes dimerisation domain [140997] (1 protein) |
| Protein Transposase Hermes, dimerisation domain [140998] (1 species) |
| Species House fly (Musca domestica) [TaxId:7370] [140999] (1 PDB entry) Uniprot Q25442 79-158! Uniprot Q25442 79-162 |
| Domain d2bw3a1: 2bw3 A:79-162 [129317] Other proteins in same PDB: d2bw3a2 |
PDB Entry: 2bw3 (more details), 2 Å
SCOPe Domain Sequences for d2bw3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bw3a1 a.270.1.1 (A:79-162) Transposase Hermes, dimerisation domain {House fly (Musca domestica) [TaxId: 7370]}
qsrelktvsadckkeaiekcaqwvvrdcrpfsavsgsgfidmikffikvkaeygehvnve
ellpspitlsrkvtsdakekkali
Timeline for d2bw3a1: