Lineage for d2bw0a2 (2bw0 A:1-203)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704461Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 704462Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 704463Family c.65.1.1: Formyltransferase [53329] (4 proteins)
  6. 704464Protein 10-formyltetrahydrofolate dehydrogenase domain 1 [102552] (2 species)
  7. 704465Species Human (Homo sapiens) [TaxId:9606] [142568] (2 PDB entries)
  8. 704466Domain d2bw0a2: 2bw0 A:1-203 [129304]
    Other proteins in same PDB: d2bw0a1
    complexed with so4

Details for d2bw0a2

PDB Entry: 2bw0 (more details), 1.7 Å

PDB Description: crystal structure of the hydrolase domain of human 10-formyltetrahydrofolate 2 dehydrogenase
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOP Domain Sequences for d2bw0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]}
mkiavigqslfgqevychlrkeghevvgvftvpdkdgkadplgleaekdgvpvfkysrwr
akgqalpdvvakyqalgaelnvlpfcsqfipmeiisaprhgsiiyhpsllprhrgasain
wtlihgdkkggfsifwaddgldtgdlllqkecevlpddtvstlynrflfpegikgmvqav
rliaegkaprlpqpeegatyegi

SCOP Domain Coordinates for d2bw0a2:

Click to download the PDB-style file with coordinates for d2bw0a2.
(The format of our PDB-style files is described here.)

Timeline for d2bw0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bw0a1