Lineage for d2bvya2 (2bvy A:5-370)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439741Protein Mannanase A, ManA [63908] (3 species)
  7. 2439744Species Cellulomonas fimi [TaxId:1708] [141776] (2 PDB entries)
    Uniprot Q9XCV5 55-420
  8. 2439745Domain d2bvya2: 2bvy A:5-370 [129302]
    Other proteins in same PDB: d2bvya1, d2bvya3
    automated match to d2bvta2
    complexed with act, cac, gol

Details for d2bvya2

PDB Entry: 2bvy (more details), 2.25 Å

PDB Description: the structure and characterization of a modular endo-beta-1,4-mannanase from cellulomonas fimi
PDB Compounds: (A:) beta-1,4-mannanase

SCOPe Domain Sequences for d2bvya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]}
tiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdfp
avfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsfy
dtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfwwg
aaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvlg
ldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkvl
aaikadpvasrnaymetwanfdagqhfvpvpgdalledfqayaadpftlfasevtgafdr
tvaaap

SCOPe Domain Coordinates for d2bvya2:

Click to download the PDB-style file with coordinates for d2bvya2.
(The format of our PDB-style files is described here.)

Timeline for d2bvya2: