![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Mannanase A, ManA [63908] (3 species) |
![]() | Species Cellulomonas fimi [TaxId:1708] [141776] (2 PDB entries) Uniprot Q9XCV5 55-420 |
![]() | Domain d2bvtb2: 2bvt B:5-370 [129300] Other proteins in same PDB: d2bvta1, d2bvta3, d2bvtb1, d2bvtb3 automated match to d2bvta2 complexed with cac |
PDB Entry: 2bvt (more details), 2.9 Å
SCOPe Domain Sequences for d2bvtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvtb2 c.1.8.3 (B:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} tiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdfp avfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsfy dtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfwwg aaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvlg ldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkvl aaikadpvasrnaymetwanfdagqhfvpvpgdalledfqayaadpftlfasevtgafdr tvaaap
Timeline for d2bvtb2: