SCOPe 2.08: Domain d2bvtb1: 2bvt B:371-464

Lineage for d2bvtb1 (2bvt B:371-464)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Beta-1,4-mannanase domain 2 (postcatalytic) [141020] (1 species)

7. Species Cellulomonas fimi [TaxId:1708] [141021] (2 PDB entries)
   Uniprot Q9XCV5 421-514

8. Domain d2bvtb1: 2bvt B:371-464 [129299]
   Other proteins in same PDB: d2bvta2, d2bvta3, d2bvtb2, d2bvtb3
   automated match to d2bvta1
   complexed with cac

Details for d2bvtb1

PDB Entry: 2bvt, 2.9 Å

PDB Description: the structure of a modular endo-beta-1,4-mannanase from cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases.

PDB Compounds: (B:) beta-1,4-mannanase

SCOPe Domain Sequences for d2bvtb1:

Sequence, based on SEQRES records:

>d2bvtb1 b.1.18.2 (B:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtnev

Sequence, based on observed residues (ATOM records):

>d2bvtb1 b.1.18.2 (B:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqvvdtldlaydgalwwtapw
spytvtatattaagtldvtnev

Timeline for d2bvtb1:

• d2bvtb1 first appeared in SCOP 1.73
  
• d2bvtb1 appears in SCOPe 2.07