Lineage for d2bvpa2 (2bvp A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937912Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 2937914Domain d2bvpa2: 2bvp A:1-181 [129292]
    Other proteins in same PDB: d2bvpa1, d2bvpb_
    automatically matched to d1a1ma2

Details for d2bvpa2

PDB Entry: 2bvp (more details), 1.35 Å

PDB Description: structures of three hiv-1 hla-b5703-peptide complexes and identification of related hlas potentially associated with long-term non-progression
PDB Compounds: (A:) hla class I histocompatibility antigen, b-57 alpha chain

SCOPe Domain Sequences for d2bvpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvpa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dgetrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghnqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2bvpa2:

Click to download the PDB-style file with coordinates for d2bvpa2.
(The format of our PDB-style files is described here.)

Timeline for d2bvpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvpa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bvpb_